PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN12754.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 90aa    MW: 10224.7 Da    PI: 11.455
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN12754.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.31.6e-17146147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++ Ed +l  +v+ +G+++W++I+r++  gR++k+c++rw + 
       KHN12754.1  1 KGPWSAKEDRILTGLVEAHGPRNWASISRHIK-GRSGKSCRLRWCNQ 46
                     79*****************************9.***********985 PP

2Myb_DNA-binding39.99.6e-135590340
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                     +++t Ede +++a++++G++ W+tIar+++ gRt++ +
       KHN12754.1 55 PFSTREDEVILHAHARFGNK-WATIARMLP-GRTDNAV 90
                     89******************.*********.****975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.2E-12149IPR001005SANT/Myb domain
PROSITE profilePS5129425.893151IPR017930Myb domain
PfamPF002491.3E-16146IPR001005SANT/Myb domain
SuperFamilySSF466892.56E-27190IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-23254IPR009057Homeodomain-like
CDDcd001679.67E-13345No hitNo description
SMARTSM007170.95290IPR001005SANT/Myb domain
PROSITE profilePS5129413.0385390IPR017930Myb domain
CDDcd001675.04E-75590No hitNo description
PfamPF002496.0E-105590IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-155590IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
KGPWSAKEDR ILTGLVEAHG PRNWASISRH IKGRSGKSCR LRWCNQLSPT VEHRPFSTRE  60
DEVILHAHAR FGNKWATIAR MLPGRTDNAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-32190493MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-3119058147MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-3119058147MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-32190493C-Myb DNA-Binding Domain
1msf_C3e-32190493C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549412.23e-61PREDICTED: transcription factor MYB98-like
SwissprotQ9FDW12e-43MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0B2PYM39e-62A0A0B2PYM3_GLYSO; Transcription factor MYB44 (Fragment)
TrEMBLK7MNR73e-61K7MNR7_SOYBN; Uncharacterized protein
STRINGGLYMA17G36370.28e-61(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.16e-46myb domain protein 73
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]